HuDSeN:901

BRCA1 breast cancer 1, early onset(NM_007294)
CS 8PCW
immunohistochemistry

Data Images
HuDSeN:901 HuDSeN:901 HuDSeN:901 HuDSeN:901 HuDSeN:901
Fetus 11557, slide 030, section 3. Fetus 11557, slide 051, section 3. Fetus 11557, slide 061, section 3. Fetus 11557, slide 071, section 3. Fetus 11557, slide 094, section 3.
HuDSeN:901 HuDSeN:901 HuDSeN:901 HuDSeN:901 HuDSeN:901
Fetus 11557, slide 106, section 3. Fetus 11557, slide 111, section 3. Fetus 11557, slide 121, section 3. Fetus 11557, slide 127, section 3. Fetus 11557, slide 139, section 3.
HuDSeN:901 HuDSeN:901
Fetus 11557, slide 150, section 3. Fetus 11557, slide 157, section 3.
Expression pattern clarity: two stars
Notes
Expression is seen in the developing brain and eye.
Detection Reagent
Type:antibody
Identifier:Anti-BRCA1
Entity Detected:BRCA1, breast cancer 1, early onset(NM_007294)
Notes:Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAV
Antibody Type:polyclonal
Raised In:rabbit
Supplier:Atlas Antibodies
Catalogue Number:HPA034966
Specimen
Organism:human
Carnegie Stage:8PCW
Preparation:section
Expression Pattern Description
Procedures
Specimen Fixation:4% paraformaldehyde
Embedding:paraffin
Visualisation method:DAB
General Information
Authors:Bianca Brandon, Tom Smallwood
Principal investigator:Prof. Susan Lindsay, Institute of Genetic Medicine, Newcastle University, International Centre for Life, Central Parkway, Newcastle upon Tyne, United Kingdom NE1 3BZ
Submitted by:Janet Kerwin, Institute of Genetic Medicine, Newcastle University, International Centre for Life, Central Parkway, Newcastle upon Tyne, UK NE1 3BZ
Experiment type:non-screen
Links: EMAGE same gene
  Allen Brain Atlas same gene
  BioGPS same gene

The HuDSeN Gene Expression Spatial database currently contains data from CS12 to CS23. We are in the process of upgrading the database to include fetal gene expression patterns spatially mapped into 3D models. In the meantime the fetal gene expression images are available to view here.


Copyright ©The Medical Research Council & University of Newcastle
All Rights Reserved.